SCOPe 2.08: Domain d6ijha1: 6ijh A:449-768

Lineage for d6ijha1 (6ijh A:449-768)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries)

8. Domain d6ijha1: 6ijh A:449-768 [367474]
   Other proteins in same PDB: d6ijha2, d6ijhb2
   automated match to d4ajmd_
   complexed with aeo, mg, zn

Details for d6ijha1

PDB Entry: 6ijh, 2.6 Å

PDB Description: crystal structure of pde10 in complex with inhibitor af-399/14387019

PDB Compounds: (A:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d6ijha1:

Sequence; same for both SEQRES and ATOM records:

>d6ijha1 a.211.1.0 (A:449-768) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelekl
crfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhr
gfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirk
aiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtklt
andiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilppt
epllkacrdnlsqwekvirg

Timeline for d6ijha1:

• d6ijha1 first appeared in SCOPe 2.07