SCOPe 2.07: Domain d6h6ja1: 6h6j A:1-149

Lineage for d6h6ja1 (6h6j A:1-149)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Neuroglobin [100978] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [109625] (36 PDB entries)
   Uniprot Q9ER97

8. Domain d6h6ja1: 6h6j A:1-149 [367455]
   Other proteins in same PDB: d6h6ja2
   automated match to d1oj6b_
   complexed with cmo, gol, hem, peg, so4, trs; mutant

Details for d6h6ja1

PDB Entry: 6h6j, 2.6 Å

PDB Description: carbomonoxy murine neuroglobin gly-loop mutant

PDB Compounds: (A:) neuroglobin

SCOPe Domain Sequences for d6h6ja1:

Sequence; same for both SEQRES and ATOM records:

>d6h6ja1 a.1.1.2 (A:1-149) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]}
merpeselirqswrvvsrsplehgtvlfarlfalepsllplfqgggqfsspedslsspef
ldhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymleksl
gpdftpatrtawsrlygavvqamsrgwdg

Timeline for d6h6ja1:

• d6h6ja1 is new in SCOPe 2.07-stable
  
• d6h6ja1 appears in the current release, SCOPe 2.08