Lineage for d6h6ja1 (6h6j A:1-149)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688341Protein Neuroglobin [100978] (2 species)
  7. 2688349Species Mouse (Mus musculus) [TaxId:10090] [109625] (38 PDB entries)
    Uniprot Q9ER97
  8. 2688387Domain d6h6ja1: 6h6j A:1-149 [367455]
    Other proteins in same PDB: d6h6ja2
    automated match to d1oj6b_
    complexed with cmo, gol, hem, peg, so4, trs; mutant

Details for d6h6ja1

PDB Entry: 6h6j (more details), 2.6 Å

PDB Description: carbomonoxy murine neuroglobin gly-loop mutant
PDB Compounds: (A:) neuroglobin

SCOPe Domain Sequences for d6h6ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h6ja1 a.1.1.2 (A:1-149) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]}
merpeselirqswrvvsrsplehgtvlfarlfalepsllplfqgggqfsspedslsspef
ldhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymleksl
gpdftpatrtawsrlygavvqamsrgwdg

SCOPe Domain Coordinates for d6h6ja1:

Click to download the PDB-style file with coordinates for d6h6ja1.
(The format of our PDB-style files is described here.)

Timeline for d6h6ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6h6ja2