Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Neuroglobin [100978] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [109625] (38 PDB entries) Uniprot Q9ER97 |
Domain d6h6ja1: 6h6j A:1-149 [367455] Other proteins in same PDB: d6h6ja2 automated match to d1oj6b_ complexed with cmo, gol, hem, peg, so4, trs; mutant |
PDB Entry: 6h6j (more details), 2.6 Å
SCOPe Domain Sequences for d6h6ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h6ja1 a.1.1.2 (A:1-149) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]} merpeselirqswrvvsrsplehgtvlfarlfalepsllplfqgggqfsspedslsspef ldhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymleksl gpdftpatrtawsrlygavvqamsrgwdg
Timeline for d6h6ja1: