![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.38: HLH-like [47458] (2 superfamilies) 4-helices; bundle, closed, left-handed twist; 2 crossover connections |
![]() | Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (2 families) ![]() dimer of two identical helix-loop-helix subunits |
![]() | Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (9 proteins) |
![]() | Protein automated matches [367408] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [367409] (3 PDB entries) |
![]() | Domain d6g6jb_: 6g6j B: [367451] Other proteins in same PDB: d6g6ja_, d6g6jc_ automated match to d1an2a_ complexed with so4 |
PDB Entry: 6g6j (more details), 2.25 Å
SCOPe Domain Sequences for d6g6jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6g6jb_ a.38.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} alerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhthqqdiddlk rqnalleqqvral
Timeline for d6g6jb_: