Lineage for d6g6jb_ (6g6j B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709988Fold a.38: HLH-like [47458] (2 superfamilies)
    4-helices; bundle, closed, left-handed twist; 2 crossover connections
  4. 2709989Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (2 families) (S)
    dimer of two identical helix-loop-helix subunits
  5. 2709990Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (9 proteins)
  6. 2710037Protein automated matches [367408] (1 species)
    not a true protein
  7. 2710038Species Human (Homo sapiens) [TaxId:9606] [367409] (3 PDB entries)
  8. 2710045Domain d6g6jb_: 6g6j B: [367451]
    Other proteins in same PDB: d6g6ja_, d6g6jc_
    automated match to d1an2a_
    complexed with so4

Details for d6g6jb_

PDB Entry: 6g6j (more details), 2.25 Å

PDB Description: the crystal structures of human myc:max bhlhzip complex
PDB Compounds: (B:) Protein max

SCOPe Domain Sequences for d6g6jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g6jb_ a.38.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhthqqdiddlk
rqnalleqqvral

SCOPe Domain Coordinates for d6g6jb_:

Click to download the PDB-style file with coordinates for d6g6jb_.
(The format of our PDB-style files is described here.)

Timeline for d6g6jb_: