Lineage for d127la_ (127l A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)
  6. Protein Phage T4 lysozyme [53982] (1 species)
  7. Species Bacteriophage T4 [TaxId:10665] [53983] (595 PDB entries)
    Uniprot P00720
    many mutant structures
  8. Domain d127la_: 127l A: [36745]
    complexed with bme, cl

Details for d127la_

PDB Entry: 127l (more details), 1.85 Å

PDB Description: the energetic cost and the structural consequences of burying a hydroxyl group within the core of a protein determined from ala to ser and val to thr substitutions in t4 lysozyme
PDB Compounds: (A:) t4 lysozyme

SCOPe Domain Sequences for d127la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d127la_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaatrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

SCOPe Domain Coordinates for d127la_ are not available.

Timeline for d127la_: