Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Neuroglobin [100978] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [109625] (36 PDB entries) Uniprot Q9ER97 |
Domain d6h6ca_: 6h6c A: [367440] automated match to d1oj6b_ complexed with cmo, dio, gol, hem, so4; mutant |
PDB Entry: 6h6c (more details), 1.75 Å
SCOPe Domain Sequences for d6h6ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h6ca_ a.1.1.2 (A:) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]} merpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspe fldhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssastvgesllymleks lgpdftpatrtawsrlygavvqamsrgwdge
Timeline for d6h6ca_: