Lineage for d6h6ca_ (6h6c A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301798Protein Neuroglobin [100978] (2 species)
  7. 2301806Species Mouse (Mus musculus) [TaxId:10090] [109625] (36 PDB entries)
    Uniprot Q9ER97
  8. 2301823Domain d6h6ca_: 6h6c A: [367440]
    automated match to d1oj6b_
    complexed with cmo, dio, gol, hem, so4; mutant

Details for d6h6ca_

PDB Entry: 6h6c (more details), 1.75 Å

PDB Description: carbomonoxy murine neuroglobin f106a mutant
PDB Compounds: (A:) neuroglobin

SCOPe Domain Sequences for d6h6ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h6ca_ a.1.1.2 (A:) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]}
merpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspe
fldhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssastvgesllymleks
lgpdftpatrtawsrlygavvqamsrgwdge

SCOPe Domain Coordinates for d6h6ca_:

Click to download the PDB-style file with coordinates for d6h6ca_.
(The format of our PDB-style files is described here.)

Timeline for d6h6ca_: