Lineage for d6h5za_ (6h5z A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301856Protein automated matches [190359] (44 species)
    not a true protein
  7. 2302197Species Mouse (Mus musculus) [TaxId:10090] [187190] (4 PDB entries)
  8. 2302199Domain d6h5za_: 6h5z A: [367438]
    automated match to d2vrya_
    complexed with dio, hem, so4; mutant

Details for d6h5za_

PDB Entry: 6h5z (more details), 1.8 Å

PDB Description: ferric murine neuroglobin f106a mutant
PDB Compounds: (A:) neuroglobin

SCOPe Domain Sequences for d6h5za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h5za_ a.1.1.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
peselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefld
hirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssastvgesllymlekslgp
dftpatrtawsrlygavvqamsrgwd

SCOPe Domain Coordinates for d6h5za_:

Click to download the PDB-style file with coordinates for d6h5za_.
(The format of our PDB-style files is described here.)

Timeline for d6h5za_: