Lineage for d6g2ue1 (6g2u E:10-212)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2498096Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2498097Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2498098Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 2498236Protein automated matches [227004] (3 species)
    not a true protein
  7. 2498275Species Homo sapiens [TaxId:9606] [353655] (2 PDB entries)
  8. 2498286Domain d6g2ue1: 6g2u E:10-212 [367432]
    Other proteins in same PDB: d6g2ua2, d6g2ub2, d6g2uc2, d6g2ud2, d6g2ue2, d6g2uf2
    automated match to d3etda1
    complexed with cl, na, po4

Details for d6g2ue1

PDB Entry: 6g2u (more details), 2.93 Å

PDB Description: crystal structure of the human glutamate dehydrogenase 2 (hgdh2)
PDB Compounds: (E:) Glutamate dehydrogenase 2, mitochondrial

SCOPe Domain Sequences for d6g2ue1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g2ue1 c.58.1.1 (E:10-212) automated matches {Homo sapiens [TaxId: 9606]}
dpnffkmvegffdrgasivedklvkdlrtqeseeqkrnrvrgilriikpcnhvlslsfpi
rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
kagvkinpknytenelekitrrftmelakkgfigpgvdvpapdmntgeremswiadtyas
tighydinahacvtgkpisqggi

SCOPe Domain Coordinates for d6g2ue1:

Click to download the PDB-style file with coordinates for d6g2ue1.
(The format of our PDB-style files is described here.)

Timeline for d6g2ue1: