SCOPe 2.07: Domain d6g40b2: 6g40 B:136-325

Lineage for d6g40b2 (6g40 B:136-325)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families)

5. Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins)

6. Protein automated matches [227058] (2 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [360610] (3 PDB entries)

8. Domain d6g40b2: 6g40 B:136-325 [367428]
   Other proteins in same PDB: d6g40a1, d6g40b1, d6g40c1, d6g40c3
   automated match to d2xhia2
   protein/DNA complex; complexed with act, elk, ni, peg

Details for d6g40b2

PDB Entry: 6g40, 2.49 Å

PDB Description: structure of the mouse 8-oxoguanine dna glycosylase mogg1 in complex with ligand th9525

PDB Compounds: (B:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d6g40b2:

Sequence; same for both SEQRES and ATOM records:

>d6g40b2 a.96.1.3 (B:136-325) automated matches {Mus musculus [TaxId: 10090]}
dpteclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpnlhalagpeaeth
lrklglgyraryvrasakaileeqggpawlqqlrvapyeeahkalctlpgvgakvadcic
lmaldkpqavpvdvhvwqiahrdygwhpktsqakgpsplankelgnffrnlwgpyagwaq
avlfsadlrq

Timeline for d6g40b2:

• d6g40b2 is new in SCOPe 2.07-stable
  
• d6g40b2 appears in the current release, SCOPe 2.08