Lineage for d6g40b1 (6g40 B:10-135)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. Family d.129.1.0: automated matches [227265] (1 protein)
    not a true family
  6. Protein automated matches [227057] (4 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [360608] (3 PDB entries)
  8. Domain d6g40b1: 6g40 B:10-135 [367427]
    Other proteins in same PDB: d6g40a2, d6g40b2, d6g40c2, d6g40c3
    automated match to d2xhia1
    protein/DNA complex; complexed with act, elk, ni, peg

Details for d6g40b1

PDB Entry: 6g40 (more details), 2.4899999999999998 Å

PDB Description: structure of the mouse 8-oxoguanine dna glycosylase mogg1 in complex with ligand th9525
PDB Compounds: (B:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d6g40b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g40b1 d.129.1.0 (B:10-135) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hmrhrtlssspalwasipcprselrldlvlasgqsfrwkeqspahwsgvladqvwtltqt
edqlyctvyrgddsqvsrptleeletlhkyfqldvslaqlyshwasvdshfqrvaqkfqg
vrllrq

SCOPe Domain Coordinates for d6g40b1 are not available.

Timeline for d6g40b1:

Domains from same chain:
(mouse over for more information)
d6g40b2
Domains from other chains:
(mouse over for more information)
d6g40a1, d6g40a2, d6g40c1, d6g40c2, d6g40c3