![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
![]() | Protein automated matches [190123] (156 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186862] (202 PDB entries) |
![]() | Domain d6g2wa_: 6g2w A: [367426] automated match to d3b9pa_ complexed with adp, awd, dms, mpd, na |
PDB Entry: 6g2w (more details), 2.68 Å
SCOPe Domain Sequences for d6g2wa_:
Sequence, based on SEQRES records: (download)
>d6g2wa_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vvevpqvtwediggledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktll akaianecqanfisikgpelltmwfgeseanvreifdkarqaapcvlffdeldsiakarg gnigdgggaadrvinqiltemdgmstkknvfiigatnrpdiidpailrpgrldqliyipl pdeksrvailkanlrkspvakdvdleflakmtngfsgadlteicqracklairesiesei rrererqtnpsameveeddpvpeirrdhfeeamrfarrsvsdndirkyemfaqtlq
>d6g2wa_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vvevpqvtwediggledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktll akaianecqanfisikgpelltseanvreifdkarqaapcvlffdeldsiakaadrvinq iltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpdeksrvailkanlrk spvakdvdleflakmtngfsgadlteicqracklairesieseirrerepvpeirrdhfe eamrfarrsvsdndirkyemfaqtlq
Timeline for d6g2wa_: