Lineage for d6g2ua1 (6g2u A:8-212)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890284Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 2890410Protein automated matches [227004] (3 species)
    not a true protein
  7. 2890449Species Human (Homo sapiens) [TaxId:9606] [353655] (2 PDB entries)
  8. 2890450Domain d6g2ua1: 6g2u A:8-212 [367422]
    Other proteins in same PDB: d6g2ua2, d6g2ub2, d6g2uc2, d6g2ud2, d6g2ue2, d6g2uf2
    automated match to d3etda1
    complexed with cl, na, po4

Details for d6g2ua1

PDB Entry: 6g2u (more details), 2.93 Å

PDB Description: crystal structure of the human glutamate dehydrogenase 2 (hgdh2)
PDB Compounds: (A:) Glutamate dehydrogenase 2, mitochondrial

SCOPe Domain Sequences for d6g2ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g2ua1 c.58.1.1 (A:8-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eddpnffkmvegffdrgasivedklvkdlrtqeseeqkrnrvrgilriikpcnhvlslsf
pirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfg
gakagvkinpknytenelekitrrftmelakkgfigpgvdvpapdmntgeremswiadty
astighydinahacvtgkpisqggi

SCOPe Domain Coordinates for d6g2ua1:

Click to download the PDB-style file with coordinates for d6g2ua1.
(The format of our PDB-style files is described here.)

Timeline for d6g2ua1: