SCOP 1.71: Domain d249l__: 249l -

Lineage for d249l__ (249l -)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.3: Phage lysozyme [53981] (3 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (405 PDB entries)
   many mutant structures

8. Domain d249l__: 249l - [36742]
   complexed with cl, hed; mutant

Details for d249l__

PDB Entry: 249l, 1.9 Å

PDB Description: the response of t4 lysozyme to large-to-small substitutions within the core and its relation to the hydrophobic effect

SCOP Domain Sequences for d249l__:

Sequence; same for both SEQRES and ATOM records:

>d249l__ d.2.1.3 (-) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytagighlltkspslnaakseldkaigrntngvatk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl

Timeline for d249l__:

• d249l__ first appeared (with stable ids) in SCOP 1.55
  
• d249l__ appears in SCOP 1.69
  
• d249l__ is called d249la_ in SCOP 1.73
  
• d249l__ appears in the current release, SCOPe 2.08, called d249la_