Lineage for d6g6kb_ (6g6k B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323159Fold a.38: HLH-like [47458] (2 superfamilies)
    4-helices; bundle, closed, left-handed twist; 2 crossover connections
  4. 2323160Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (2 families) (S)
    dimer of two identical helix-loop-helix subunits
  5. 2323161Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (9 proteins)
  6. 2323208Protein automated matches [367408] (1 species)
    not a true protein
  7. 2323209Species Homo sapiens [TaxId:9606] [367409] (3 PDB entries)
  8. 2323210Domain d6g6kb_: 6g6k B: [367410]
    automated match to d1an2a_
    complexed with cl

Details for d6g6kb_

PDB Entry: 6g6k (more details), 1.35 Å

PDB Description: the crystal structures of human myc:max bhlhzip complex
PDB Compounds: (B:) Protein max

SCOPe Domain Sequences for d6g6kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g6kb_ a.38.1.1 (B:) automated matches {Homo sapiens [TaxId: 9606]}
ahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhthqqdi
ddlkrqnalleqqvra

SCOPe Domain Coordinates for d6g6kb_:

Click to download the PDB-style file with coordinates for d6g6kb_.
(The format of our PDB-style files is described here.)

Timeline for d6g6kb_: