Lineage for d6g6lg_ (6g6l G:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323159Fold a.38: HLH-like [47458] (2 superfamilies)
    4-helices; bundle, closed, left-handed twist; 2 crossover connections
  4. 2323160Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (2 families) (S)
    dimer of two identical helix-loop-helix subunits
  5. 2323218Family a.38.1.0: automated matches [324429] (1 protein)
    not a true family
  6. 2323219Protein automated matches [324430] (1 species)
    not a true protein
  7. 2323220Species Human (Homo sapiens) [TaxId:9606] [324431] (3 PDB entries)
  8. 2323226Domain d6g6lg_: 6g6l G: [367405]
    Other proteins in same PDB: d6g6lb_, d6g6ld_, d6g6lf_, d6g6lh_
    automated match to d5i4za_
    complexed with so4

Details for d6g6lg_

PDB Entry: 6g6l (more details), 2.2 Å

PDB Description: the crystal structures of human myc:max bhlhzip complex
PDB Compounds: (G:) myc proto-oncogene protein

SCOPe Domain Sequences for d6g6lg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g6lg_ a.38.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlerqrrnelkrsffalrdqipelennekapkvvilkkatayilsvqaeeqkliseedll
rkrreqlkhkleqlrns

SCOPe Domain Coordinates for d6g6lg_:

Click to download the PDB-style file with coordinates for d6g6lg_.
(The format of our PDB-style files is described here.)

Timeline for d6g6lg_: