SCOPe 2.07: Domain d6enga2: 6eng A:221-392

Lineage for d6enga2 (6eng A:221-392)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.0: automated matches [191504] (1 protein)
   not a true family

6. Protein automated matches [190826] (22 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [271300] (6 PDB entries)

8. Domain d6enga2: 6eng A:221-392 [367390]
   Other proteins in same PDB: d6enga1
   automated match to d4prxa2
   complexed with bhw, cl, k, na, pg4, po4

Details for d6enga2

PDB Entry: 6eng, 2.3 Å

PDB Description: crystal structure of the 43k atpase domain of escherichia coli gyrase b in complex with an aminocoumarin

PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d6enga2:

Sequence, based on SEQRES records:

>d6enga2 d.14.1.0 (A:221-392) automated matches {Escherichia coli [TaxId: 83333]}
gikafveylnknktpihpnifyfstekdgigvevalqwndgfqeniycftnnipqrdggt
hlagfraamtrtlnaymdkegyskkakvsatgddaregliavvsvkvpdpkfssqtkdkl
vssevksaveqqmnellaeyllenptdakivvgkiidaarareaarraremt

Sequence, based on observed residues (ATOM records):

>d6enga2 d.14.1.0 (A:221-392) automated matches {Escherichia coli [TaxId: 83333]}
gikafveylnknktpihpnifyfstekdgigvevalqwndgfqeniycftnnipqrdggt
hlagfraamtrtlnaymdkegyskaregliavvsvkvpdpkfssqtkdklvssevksave
qqmnellaeyllenptdakivvgkiidaarareaarraremt

Timeline for d6enga2:

• d6enga2 is new in SCOPe 2.07-stable
  
• d6enga2 appears in the current release, SCOPe 2.08