Lineage for d6enga2 (6eng A:221-392)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930912Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2930913Protein automated matches [190826] (23 species)
    not a true protein
  7. 2930998Species Escherichia coli [TaxId:83333] [271300] (6 PDB entries)
  8. 2931003Domain d6enga2: 6eng A:221-392 [367390]
    Other proteins in same PDB: d6enga1
    automated match to d4prxa2
    complexed with bhw, cl, k, na, pg4, po4

Details for d6enga2

PDB Entry: 6eng (more details), 2.3 Å

PDB Description: crystal structure of the 43k atpase domain of escherichia coli gyrase b in complex with an aminocoumarin
PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d6enga2:

Sequence, based on SEQRES records: (download)

>d6enga2 d.14.1.0 (A:221-392) automated matches {Escherichia coli [TaxId: 83333]}
gikafveylnknktpihpnifyfstekdgigvevalqwndgfqeniycftnnipqrdggt
hlagfraamtrtlnaymdkegyskkakvsatgddaregliavvsvkvpdpkfssqtkdkl
vssevksaveqqmnellaeyllenptdakivvgkiidaarareaarraremt

Sequence, based on observed residues (ATOM records): (download)

>d6enga2 d.14.1.0 (A:221-392) automated matches {Escherichia coli [TaxId: 83333]}
gikafveylnknktpihpnifyfstekdgigvevalqwndgfqeniycftnnipqrdggt
hlagfraamtrtlnaymdkegyskaregliavvsvkvpdpkfssqtkdklvssevksave
qqmnellaeyllenptdakivvgkiidaarareaarraremt

SCOPe Domain Coordinates for d6enga2:

Click to download the PDB-style file with coordinates for d6enga2.
(The format of our PDB-style files is described here.)

Timeline for d6enga2: