Lineage for d6enga1 (6eng A:12-220)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579776Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2579777Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2580554Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2580555Protein automated matches [226867] (21 species)
    not a true protein
  7. 2580592Species Escherichia coli [TaxId:83333] [271298] (14 PDB entries)
  8. 2580611Domain d6enga1: 6eng A:12-220 [367389]
    Other proteins in same PDB: d6enga2
    automated match to d4prxa1
    complexed with bhw, cl, k, na, pg4, po4

Details for d6enga1

PDB Entry: 6eng (more details), 2.3 Å

PDB Description: crystal structure of the 43k atpase domain of escherichia coli gyrase b in complex with an aminocoumarin
PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d6enga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6enga1 d.122.1.0 (A:12-220) automated matches {Escherichia coli [TaxId: 83333]}
vlkgldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiivtihadnsvsv
qddgrgiptgihpeegvsaaevimtvlhaggkfddnsykvsgglhgvgvsvvnalsqkle
lviqregkihrqiyehgvpqaplavtgetektgtmvrfwpsletftnvtefeyeilakrl
relsflnsgvsirlrdkrdgkedhfhyeg

SCOPe Domain Coordinates for d6enga1:

Click to download the PDB-style file with coordinates for d6enga1.
(The format of our PDB-style files is described here.)

Timeline for d6enga1: