Lineage for d6g1fd1 (6g1f D:2-441)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897836Species Pseudomonas stutzeri [TaxId:316] [267772] (3 PDB entries)
  8. 2897842Domain d6g1fd1: 6g1f D:2-441 [367373]
    Other proteins in same PDB: d6g1fa2, d6g1fb2, d6g1fd2, d6g1fe2, d6g1ff2
    automated match to d2cy8a_

Details for d6g1fd1

PDB Entry: 6g1f (more details), 2.25 Å

PDB Description: crystal structure of d-phenylglycine aninotransferase (d-phgat) from pseudomonas stutzeri with plp internal aldimine
PDB Compounds: (D:) D-phenylglycine aminotransferase

SCOPe Domain Sequences for d6g1fd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g1fd1 c.67.1.0 (D:2-441) automated matches {Pseudomonas stutzeri [TaxId: 316]}
silndykrktegsvfwaqrarsvmpdgvtadtrvfdphglfisdaqgvhktdvdgnvyld
ffgghgalvlghghprvnaaiaealshgvqyaashplevrwaerivaafpsirklrftgs
gtettllalrvaraftgrrmilriathyhgwhdfsasgynshfdgqpapgvlpeiakntl
lirpddiegmrevfaqhgsdiaafiaepvgshfgvtpvsdsflregaelarqygalfild
evisgfrvgnhgmqalldvqpdltclakasagglpggilggredvmgvlsrgsdrkvlhq
gtftgnpitaaaaiaaidtileddvcakindlgqfareamnhlfarkglnwlaygrfsgf
hlmpglppnttdtgsitraevarpdvkmiaamrmalilegvdiggrgsvflsaqherehv
ehlvttfdrvldrladenll

SCOPe Domain Coordinates for d6g1fd1:

Click to download the PDB-style file with coordinates for d6g1fd1.
(The format of our PDB-style files is described here.)

Timeline for d6g1fd1: