Lineage for d6g2va_ (6g2v A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872051Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)
  8. 2872175Domain d6g2va_: 6g2v A: [367372]
    automated match to d3b9pa_
    complexed with adp, dms, mpd

Details for d6g2va_

PDB Entry: 6g2v (more details), 1.9 Å

PDB Description: crystal structure of the p97 d2 domain in a helical split-washer conformation
PDB Compounds: (A:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d6g2va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g2va_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vvevpqvtwediggledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktll
akaianecqanfisikgpelltseanvreifdkarqaapcvlffdeldsiakaadrvinq
iltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpdeksrvailkanlrk
spvakdvdleflakmtngfsgadlteicqracklairesieseirrerevpeirrdhfee
amrfarrsvsdndirkyemfaqtlqq

SCOPe Domain Coordinates for d6g2va_:

Click to download the PDB-style file with coordinates for d6g2va_.
(The format of our PDB-style files is described here.)

Timeline for d6g2va_: