Lineage for d6g2ud2 (6g2u D:213-503)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2453552Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 2453840Protein automated matches [227005] (6 species)
    not a true protein
  7. 2453900Species Homo sapiens [TaxId:9606] [353659] (4 PDB entries)
  8. 2453912Domain d6g2ud2: 6g2u D:213-503 [367367]
    Other proteins in same PDB: d6g2ua1, d6g2ub1, d6g2uc1, d6g2ud1, d6g2ue1, d6g2uf1
    automated match to d3etda2
    complexed with cl, na, po4

Details for d6g2ud2

PDB Entry: 6g2u (more details), 2.93 Å

PDB Description: crystal structure of the human glutamate dehydrogenase 2 (hgdh2)
PDB Compounds: (D:) Glutamate dehydrogenase 2, mitochondrial

SCOPe Domain Sequences for d6g2ud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g2ud2 c.2.1.7 (D:213-503) automated matches {Homo sapiens [TaxId: 9606]}
hgrisatgrgvfhgienfineasymsilgmtpgfrdktfvvqgfgnvglhsmrylhrfga
kciavgesdgsiwnpdgidpkeledfklqhgsilgfpkakpyegsilevdcdilipaate
kqltksnaprvkakiiaegangpttpeadkiflernilvipdlylnaggvtvsyfewlkn
lnhvsygrltfkyerdsnyhlllsvqeslerkfgkhggtipivptaefqdsisgasekdi
vhsalaytmersarqimhtamkynlgldlrtaayvnaiekvfkvyseagvt

SCOPe Domain Coordinates for d6g2ud2:

Click to download the PDB-style file with coordinates for d6g2ud2.
(The format of our PDB-style files is described here.)

Timeline for d6g2ud2: