![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
![]() | Protein automated matches [227005] (6 species) not a true protein |
![]() | Species Homo sapiens [TaxId:9606] [353659] (4 PDB entries) |
![]() | Domain d6g2ud2: 6g2u D:213-503 [367367] Other proteins in same PDB: d6g2ua1, d6g2ub1, d6g2uc1, d6g2ud1, d6g2ue1, d6g2uf1 automated match to d3etda2 complexed with cl, na, po4 |
PDB Entry: 6g2u (more details), 2.93 Å
SCOPe Domain Sequences for d6g2ud2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6g2ud2 c.2.1.7 (D:213-503) automated matches {Homo sapiens [TaxId: 9606]} hgrisatgrgvfhgienfineasymsilgmtpgfrdktfvvqgfgnvglhsmrylhrfga kciavgesdgsiwnpdgidpkeledfklqhgsilgfpkakpyegsilevdcdilipaate kqltksnaprvkakiiaegangpttpeadkiflernilvipdlylnaggvtvsyfewlkn lnhvsygrltfkyerdsnyhlllsvqeslerkfgkhggtipivptaefqdsisgasekdi vhsalaytmersarqimhtamkynlgldlrtaayvnaiekvfkvyseagvt
Timeline for d6g2ud2: