SCOPe 2.07: Domain d6cxed1: 6cxe D:2-112

Lineage for d6cxed1 (6cxe D:2-112)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d6cxed1: 6cxe D:2-112 [367351]
   Other proteins in same PDB: d6cxea1, d6cxeb_, d6cxec2
   automated match to d3q5ya1
   complexed with em4, fuc, na, nag

Details for d6cxed1

PDB Entry: 6cxe, 2.05 Å

PDB Description: structure of alpha-gsa[26,6p] bound by cd1d and in complex with the va14vb8.2 tcr

PDB Compounds: (D:) Chimeric T cell antigen receptor beta chain Vb8.2, vb11

SCOPe Domain Sequences for d6cxed1:

Sequence; same for both SEQRES and ATOM records:

>d6cxed1 b.1.1.0 (D:2-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqenfslilelatpsqtsvyfcasgdegytqyfgpgtrllvle

Timeline for d6cxed1:

• d6cxed1 is new in SCOPe 2.07-stable
  
• d6cxed1 appears in the current release, SCOPe 2.08