Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries) |
Domain d6cx7a1: 6cx7 A:7-185 [367338] Other proteins in same PDB: d6cx7a2, d6cx7b_, d6cx7c1, d6cx7c2, d6cx7d1, d6cx7d2 automated match to d1zt4c2 complexed with elm, na, nag, plm |
PDB Entry: 6cx7 (more details), 2.6 Å
SCOPe Domain Sequences for d6cx7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cx7a1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]} nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek
Timeline for d6cx7a1: