SCOPe 2.08: Domain d6a3nb_: 6a3n B:

Lineage for d6a3nb_ (6a3n B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A [109942] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109943] (22 PDB entries)
   Uniprot O76083 241-566

8. Domain d6a3nb_: 6a3n B: [367332]
   automated match to d4qgea_
   complexed with 9q9, mg, zn

Details for d6a3nb_

PDB Entry: 6a3n, 2.6 Å

PDB Description: crystal structure of the pde9 catalytic domain in complex with inhibitor 2

PDB Compounds: (B:) High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A

SCOPe Domain Sequences for d6a3nb_:

Sequence; same for both SEQRES and ATOM records:

>d6a3nb_ a.211.1.2 (B:) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A {Human (Homo sapiens) [TaxId: 9606]}
kyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlfcvhd
nyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgynntyq
inartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitlilatd
marhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdclleey
fmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeimlqplw
esrdryeelkriddamkelqkk

Timeline for d6a3nb_:

• d6a3nb_ first appeared in SCOPe 2.07