SCOPe 2.07: Domain d6cywa2: 6cyw A:186-279

Lineage for d6cywa2 (6cyw A:186-279)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d6cywa2: 6cyw A:186-279 [367317]
   Other proteins in same PDB: d6cywa1, d6cywb_
   automated match to d1zt4c1
   complexed with fo4, nag

Details for d6cywa2

PDB Entry: 6cyw, 1.95 Å

PDB Description: structure of sphingomyelin in complex with mouse cd1d

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d6cywa2:

Sequence, based on SEQRES records:

>d6cywa2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records):

>d6cywa2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpsghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylq
atldveageeaglacrvkhsslggqdiilyw

Timeline for d6cywa2:

• d6cywa2 is new in SCOPe 2.07-stable
  
• d6cywa2 appears in the current release, SCOPe 2.08