Lineage for d184l__ (184l -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.2: Lysozyme-like [53954] (1 superfamily) Superfamily d.2.1: Lysozyme-like [53955] (7 families) 
Family d.2.1.3: Phage T4 lysozyme [53981] (1 protein) Protein Phage T4 lysozyme [53982] (1 species) Species Bacteriophage T4 [TaxId:10665] [53983] (336 PDB entries) 
Domain d184l__: 184l - [36731]
Details for d184l__
PDB Entry: 184l (more details), 1.8 Å
PDB Description: specificity of ligand binding in a buried non-polar cavity of t4 lysozyme: linkage of dynamics and structural plasticity
SCOP Domain Sequences for d184l__:
Sequence; same for both SEQRES and ATOM records: (download)
>d184l__ d.2.1.3 (-) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraaainmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk
SCOP Domain Coordinates for d184l__:
Click to download the PDB-style file with coordinates for d184l__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d184l__:
- d184l__ appears in SCOP 1.57
- d184l__ appears in the current release, SCOPe 2.08, called d184la_
View in 3D