Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.1: Rotary ATPase ring subunits [81333] (2 families) automatically mapped to Pfam PF00137 |
Family f.17.1.0: automated matches [367203] (1 protein) not a true family |
Protein automated matches [367204] (2 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [367205] (1 PDB entry) |
Domain d6o7um2: 6o7u m:82-160 [367302] Other proteins in same PDB: d6o7ud_, d6o7ug1, d6o7uh1, d6o7ui1, d6o7uj1, d6o7uk1, d6o7ul1, d6o7um1, d6o7un1 automated match to d3j9tr2 |
PDB Entry: 6o7u (more details), 3.1 Å
SCOPe Domain Sequences for d6o7um2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6o7um2 f.17.1.0 (m:82-160) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} qalytgfiqlgaglsvglsglaagfaigivgdagvrgssqqprlfvgmililifaevlgl yglivalllnsratqdvvc
Timeline for d6o7um2: