Lineage for d6o7um2 (6o7u m:82-160)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023860Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 3023861Superfamily f.17.1: Rotary ATPase ring subunits [81333] (2 families) (S)
    automatically mapped to Pfam PF00137
  5. 3023979Family f.17.1.0: automated matches [367203] (1 protein)
    not a true family
  6. 3023980Protein automated matches [367204] (2 species)
    not a true protein
  7. 3023981Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [367205] (1 PDB entry)
  8. 3023988Domain d6o7um2: 6o7u m:82-160 [367302]
    Other proteins in same PDB: d6o7ud_, d6o7ug1, d6o7uh1, d6o7ui1, d6o7uj1, d6o7uk1, d6o7ul1, d6o7um1, d6o7un1
    automated match to d3j9tr2

Details for d6o7um2

PDB Entry: 6o7u (more details), 3.1 Å

PDB Description: saccharomyces cerevisiae v-atpase stv1-vo
PDB Compounds: (m:) V-type proton ATPase subunit C

SCOPe Domain Sequences for d6o7um2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6o7um2 f.17.1.0 (m:82-160) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qalytgfiqlgaglsvglsglaagfaigivgdagvrgssqqprlfvgmililifaevlgl
yglivalllnsratqdvvc

SCOPe Domain Coordinates for d6o7um2:

Click to download the PDB-style file with coordinates for d6o7um2.
(The format of our PDB-style files is described here.)

Timeline for d6o7um2: