Lineage for d5zxka1 (5zxk A:298-482)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. Protein automated matches [190437] (67 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187655] (108 PDB entries)
  8. Domain d5zxka1: 5zxk A:298-482 [367284]
    Other proteins in same PDB: d5zxka2
    automated match to d5lyga_
    complexed with h6p

Details for d5zxka1

PDB Entry: 5zxk (more details), 1.96 Å

PDB Description: crystal structure of intracellular b30.2 domain of btn3a1 in complex with hmbpp
PDB Compounds: (A:) Butyrophilin subfamily 3 member A1

SCOPe Domain Sequences for d5zxka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zxka1 b.29.1.0 (A:298-482) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aynewkkalfkpadvildpktanpillvsedqrsvqrakepqdlpdnperfnwhycvlgc
esfisgrhywevevgdrkewhigvcsknvqrkgwvkmtpengfwtmgltdgnkyrtltep
rtnlklpkppkkvgvfldyetgdisfynavdgshihtfldvsfsealypvfriltlepta
lticp

SCOPe Domain Coordinates for d5zxka1 are not available.

Timeline for d5zxka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5zxka2