Lineage for d5zj3b_ (5zj3 B:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2583928Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2583929Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2584197Family g.8.1.0: automated matches [191505] (1 protein)
    not a true family
  6. 2584198Protein automated matches [190829] (13 species)
    not a true protein
  7. 2584246Species Pseudonaja textilis [TaxId:169397] [188742] (4 PDB entries)
  8. 3067218Domain d5zj3b_: 5zj3 B: [367280]
    automated match to d1jc6a_

Details for d5zj3b_

PDB Entry: 5zj3 (more details), 1.88 Å

PDB Description: textilinin-1, a kunitz-type serine protease inhibitor from pichia expression system
PDB Compounds: (B:) Kunitz-type serine protease inhibitor textilinin-1

SCOPe Domain Sequences for d5zj3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zj3b_ g.8.1.0 (B:) automated matches {Pseudonaja textilis [TaxId: 169397]}
kdrpdfcelpadtgpcrvrfpsfyynpdekkclefiyggcegnannfitkeecestca

SCOPe Domain Coordinates for d5zj3b_:

Click to download the PDB-style file with coordinates for d5zj3b_.
(The format of our PDB-style files is described here.)

Timeline for d5zj3b_:

  • d5zj3b_ is new in SCOPe 2.07-stable