SCOPe 2.08: Domain d6o9pa1: 6o9p A:37-236

Lineage for d6o9pa1 (6o9p A:37-236)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.0: automated matches [227201] (1 protein)
   not a true family

6. Protein automated matches [226931] (12 species)
   not a true protein

7. Species Santalum album [TaxId:35974] [367258] (11 PDB entries)

8. Domain d6o9pa1: 6o9p A:37-236 [367264]
   Other proteins in same PDB: d6o9pa2
   automated match to d2onha1
   complexed with bfq, edo, mg

Details for d6o9pa1

PDB Entry: 6o9p, 2.1 Å

PDB Description: wild-type sasqs1 complexed with ibandronate

PDB Compounds: (A:) Sesquisabinene B synthase 1

SCOPe Domain Sequences for d6o9pa1:

Sequence, based on SEQRES records:

>d6o9pa1 a.102.4.0 (A:37-236) automated matches {Santalum album [TaxId: 35974]}
wdydflqslgrhssvteehvglaeklkgevkslitgpmeplaklefidsvrrlglkyqfe
temkealaniskdgydswwvdnlratalrfrllrengifvpqdvferfqnketgkfknel
cedvkgllnlyeasflgwegedildeartfstaqlknvegkisspnlakivhhaldlplh
wrairyearwfidiyedeed

Sequence, based on observed residues (ATOM records):

>d6o9pa1 a.102.4.0 (A:37-236) automated matches {Santalum album [TaxId: 35974]}
wdydflqslgrheehvglaeklkgevkslitgpmeplaklefidsvrrlglkyqfetemk
ealaniskdgydswwvdnlratalrfrllrengifvpqdvferfqnketgkfknelcedv
kgllnlyeasflgwegedildeartfstaqlknvegkisspnlakivhhaldlplhwrai
ryearwfidiyedeed

Timeline for d6o9pa1:

• d6o9pa1 first appeared in SCOPe 2.07