SCOPe 2.08: Domain d6o3aa2: 6o3a A:107-212

Lineage for d6o3aa2 (6o3a A:107-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6o3aa2: 6o3a A:107-212 [367263]
   Other proteins in same PDB: d6o3aa1, d6o3ab_, d6o3ae_
   automated match to d4jg1l2
   complexed with cxs, edo, na, nag

Details for d6o3aa2

PDB Entry: 6o3a, 2.1 Å

PDB Description: crystal structure of frizzled 7 crd in complex with f7.b fab

PDB Compounds: (A:) Antibody F7.B Fab, Light chain

SCOPe Domain Sequences for d6o3aa2:

Sequence; same for both SEQRES and ATOM records:

>d6o3aa2 b.1.1.2 (A:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d6o3aa2:

• d6o3aa2 first appeared in SCOPe 2.07