Lineage for d6o3aa2 (6o3a A:107-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750357Domain d6o3aa2: 6o3a A:107-212 [367263]
    Other proteins in same PDB: d6o3aa1, d6o3ab_, d6o3ae_
    automated match to d4jg1l2
    complexed with cxs, edo, na, nag

Details for d6o3aa2

PDB Entry: 6o3a (more details), 2.1 Å

PDB Description: crystal structure of frizzled 7 crd in complex with f7.b fab
PDB Compounds: (A:) Antibody F7.B Fab, Light chain

SCOPe Domain Sequences for d6o3aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6o3aa2 b.1.1.2 (A:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d6o3aa2:

Click to download the PDB-style file with coordinates for d6o3aa2.
(The format of our PDB-style files is described here.)

Timeline for d6o3aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6o3aa1