SCOPe 2.07: Domain d6qtna2: 6qtn A:246-437

Lineage for d6qtna2 (6qtn A:246-437)

Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
Protein automated matches [227071] (7 species)
not a true protein
Species Cow (Bos taurus) [TaxId:9913] [226565] (145 PDB entries)

Domain d6qtna2: 6qtn A:246-437 [367215]
Other proteins in same PDB: d6qtna1, d6qtnb1, d6qtnc1, d6qtnd1, d6qtne_, d6qtnf1, d6qtnf2, d6qtnf3
automated match to d4i50a2
complexed with acp, ca, edo, gdp, gol, gtp, jhh, mes, mg

Details for d6qtna2

PDB Entry: 6qtn (more details), 1.9 Å

PDB Description: tubulin-cyclostreptin complex

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d6qtna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qtna2 d.79.2.1 (A:246-437) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgv

SCOPe Domain Coordinates for d6qtna2:

Click to download the PDB-style file with coordinates for d6qtna2.
(The format of our PDB-style files is described here.)

Timeline for d6qtna2: