SCOPe 2.07: Domain d6o3ba2: 6o3b A:108-213

Lineage for d6o3ba2 (6o3b A:108-213)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (17 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
Domain d6o3ba2: 6o3b A:108-213 [367213]
Other proteins in same PDB: d6o3ba1, d6o3bc1, d6o3bc2, d6o3be1, d6o3bh1, d6o3bh2
automated match to d4jg1l2
complexed with gol, nag

Details for d6o3ba2

PDB Entry: 6o3b (more details), 2.5 Å

PDB Description: crystal structure of frizzled 7 crd in complex with f6 fab

PDB Compounds: (A:) Antibody Fab F6, Light chain

SCOPe Domain Sequences for d6o3ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6o3ba2 b.1.1.2 (A:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d6o3ba2:

Click to download the PDB-style file with coordinates for d6o3ba2.
(The format of our PDB-style files is described here.)

Timeline for d6o3ba2: