SCOP 1.57: Domain d120l__: 120l -

Lineage for d120l__ (120l -)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.3: Phage T4 lysozyme [53981] (1 protein)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (348 PDB entries)

8. Domain d120l__: 120l - [36720]

Details for d120l__

PDB Entry: 120l, 1.8 Å

PDB Description: the energetic cost and the structural consequences of burying a hydroxyl group within the core of a protein determined from ala to ser and val to thr substitutions in t4 lysozyme

SCOP Domain Sequences for d120l__:

Sequence; same for both SEQRES and ATOM records:

>d120l__ d.2.1.3 (-) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnsakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

Timeline for d120l__:

• d120l__ first appeared (with stable ids) in SCOP 1.55
  
• d120l__ appears in SCOP 1.59
  
• d120l__ appears in the current release, SCOPe 2.08, called d120la_