SCOPe 2.08: Domain d120la_: 120l A:

Lineage for d120la_ (120l A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (595 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d120la_: 120l A: [36720]
   complexed with bme, cl

Details for d120la_

PDB Entry: 120l, 1.8 Å

PDB Description: the energetic cost and the structural consequences of burying a hydroxyl group within the core of a protein determined from ala to ser and val to thr substitutions in t4 lysozyme

PDB Compounds: (A:) t4 lysozyme

SCOPe Domain Sequences for d120la_:

Sequence; same for both SEQRES and ATOM records:

>d120la_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnsakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

Timeline for d120la_:

• d120la_ first appeared (with stable ids) in SCOP 1.55, called d120l__
  
• d120la_ appears in SCOPe 2.07