SCOPe 2.08: Domain d6o3bc1: 6o3b C:42-165

Lineage for d6o3bc1 (6o3b C:42-165)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.141: Frizzled cysteine-rich domain [63500] (1 superfamily)
   Core: 3 helices; irregular array; disulfide-rich

4. Superfamily a.141.1: Frizzled cysteine-rich domain [63501] (2 families)
   automatically mapped to Pfam PF01392

5. Family a.141.1.0: automated matches [274414] (1 protein)
   not a true family

6. Protein automated matches [274417] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [274420] (11 PDB entries)

8. Domain d6o3bc1: 6o3b C:42-165 [367198]
   Other proteins in same PDB: d6o3ba1, d6o3ba2, d6o3bb_, d6o3bc2, d6o3be1, d6o3be2, d6o3bg_, d6o3bh2
   automated match to d5urvb_
   complexed with gol, nag

Details for d6o3bc1

PDB Entry: 6o3b, 2.5 Å

PDB Description: crystal structure of frizzled 7 crd in complex with f6 fab

PDB Compounds: (C:) Frizzled-7

SCOPe Domain Sequences for d6o3bc1:

Sequence; same for both SEQRES and ATOM records:

>d6o3bc1 a.141.1.0 (C:42-165) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svpdhgfcqpisiplctdiaynqtilpnllghtnqedaglevhqfyplvkvqcspelrff
lcsmyapvctvldqaippcrslcerarqgcealmnkfgfqwperlrcenfpvhgageicv
gqnt

Timeline for d6o3bc1:

• d6o3bc1 first appeared in SCOPe 2.07