Lineage for d181l__ (181l -)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 497065Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 497066Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 497622Family d.2.1.3: Phage T4 lysozymes [53981] (2 proteins)
  6. 497623Protein Phage T4 lysozyme [53982] (1 species)
  7. 497624Species Bacteriophage T4 [TaxId:10665] [53983] (397 PDB entries)
    many mutant structures
  8. 497702Domain d181l__: 181l - [36718]

Details for d181l__

PDB Entry: 181l (more details), 1.8 Å

PDB Description: specificity of ligand binding in a buried non-polar cavity of t4 lysozyme: linkage of dynamics and structural plasticity

SCOP Domain Sequences for d181l__:

Sequence; same for both SEQRES and ATOM records: (download)

>d181l__ d.2.1.3 (-) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraaainmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

SCOP Domain Coordinates for d181l__:

Click to download the PDB-style file with coordinates for d181l__.
(The format of our PDB-style files is described here.)

Timeline for d181l__: