SCOPe 2.08: Domain d6m9zd_: 6m9z D:

Lineage for d6m9zd_ (6m9z D:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (26 species)
   not a true protein

7. Species Branchiostoma floridae [TaxId:7739] [226665] (5 PDB entries)

8. Domain d6m9zd_: 6m9z D: [367168]
   automated match to d4jgeb_

Details for d6m9zd_

PDB Entry: 6m9z, 1.2 Å

PDB Description: x-ray structure of branchiostoma floridae fluorescent protein lanfp6g

PDB Compounds: (D:) Fluorescent protein lanFP6G

SCOPe Domain Sequences for d6m9zd_:

Sequence; same for both SEQRES and ATOM records:

>d6m9zd_ d.22.1.0 (D:) automated matches {Branchiostoma floridae [TaxId: 7739]}
plpkthelhifgsfngvkfdmvgegtgnpnegseelklkstngplkfspyilvphlggyg
ygfnqylpfpdgmspfqaamqdesgyqvhrtlqyedgafvtanlrytyegshikgefqvi
gtgfppdgpvmtnkltaldwsvvkfvypndktilstfdktytttdgkryqctfrenntfa
kpmaadilqkqpmfifhktelqhsnnaeltfkekqtafsdm

Timeline for d6m9zd_:

• d6m9zd_ first appeared in SCOPe 2.07