SCOPe 2.07: Domain d6j0lb_: 6j0l B:

Lineage for d6j0lb_ (6j0l B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (66 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187655] (107 PDB entries)

8. Domain d6j0lb_: 6j0l B: [367165]
   automated match to d5lyga_
   complexed with so4; mutant

Details for d6j0lb_

PDB Entry: 6j0l, 1.95 Å

PDB Description: crystal structure of intracellular b30.2 domain of btn3a3 mutant in complex with sulfate ion

PDB Compounds: (B:) Butyrophilin subfamily 3 member A3

SCOPe Domain Sequences for d6j0lb_:

Sequence; same for both SEQRES and ATOM records:

>d6j0lb_ b.29.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ayhewkmalfkpadvildpdtanaillvsedqrsvqraeeprdlpdnperfewhycvlgc
enftsgrhywevevgdrkewhigvcsknverkkgwvkmtpengywtmgltdgnkyralte
prtnlklpepprkvgifldyetgeisfynatdgshiytfphasfseplypvfriltlept
alticpi

Timeline for d6j0lb_:

• d6j0lb_ is new in SCOPe 2.07-stable
  
• d6j0lb_ appears in the current release, SCOPe 2.08