Lineage for d6j0la_ (6j0l A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780893Species Human (Homo sapiens) [TaxId:9606] [187655] (109 PDB entries)
  8. 2781056Domain d6j0la_: 6j0l A: [367162]
    automated match to d5lyga_
    complexed with so4; mutant

Details for d6j0la_

PDB Entry: 6j0l (more details), 1.95 Å

PDB Description: crystal structure of intracellular b30.2 domain of btn3a3 mutant in complex with sulfate ion
PDB Compounds: (A:) Butyrophilin subfamily 3 member A3

SCOPe Domain Sequences for d6j0la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j0la_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yhewkmalfkpadvildpdtanaillvsedqrsvqraeeprdlpdnperfewhycvlgce
nftsgrhywevevgdrkewhigvcsknverkkgwvkmtpengywtmgltdgnkyraltep
rtnlklpepprkvgifldyetgeisfynatdgshiytfphasfseplypvfriltlepta
lticpip

SCOPe Domain Coordinates for d6j0la_:

Click to download the PDB-style file with coordinates for d6j0la_.
(The format of our PDB-style files is described here.)

Timeline for d6j0la_: