Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (70 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187655] (109 PDB entries) |
Domain d6j0la_: 6j0l A: [367162] automated match to d5lyga_ complexed with so4; mutant |
PDB Entry: 6j0l (more details), 1.95 Å
SCOPe Domain Sequences for d6j0la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6j0la_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} yhewkmalfkpadvildpdtanaillvsedqrsvqraeeprdlpdnperfewhycvlgce nftsgrhywevevgdrkewhigvcsknverkkgwvkmtpengywtmgltdgnkyraltep rtnlklpepprkvgifldyetgeisfynatdgshiytfphasfseplypvfriltlepta lticpip
Timeline for d6j0la_: