SCOPe 2.07: Domain d6isma1: 6ism A:298-482

Lineage for d6isma1 (6ism A:298-482)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (66 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187655] (107 PDB entries)

8. Domain d6isma1: 6ism A:298-482 [367153]
   Other proteins in same PDB: d6isma2
   automated match to d5lyga_
   mutant

Details for d6isma1

PDB Entry: 6ism, 1.25 Å

PDB Description: crystal structure of intracellular b30.2 domain of btn3a1 mutant

PDB Compounds: (A:) Butyrophilin subfamily 3 member A1

SCOPe Domain Sequences for d6isma1:

Sequence; same for both SEQRES and ATOM records:

>d6isma1 b.29.1.0 (A:298-482) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ayneakkaafkpadvildpktanpillvsedqrsvqrakepqdlpdnperfnwhycvlgc
esfisgrhywevevgdrkewhigvcsknvqrkgwvkmtpengfwtmgltdgnkyrtltep
rtnlklpkppkkvgvfldyetgdisfynavdgshihtfldvsfsealypvfriltlepta
lticp

Timeline for d6isma1:

• d6isma1 is new in SCOPe 2.07-stable
  
• d6isma1 appears in the current release, SCOPe 2.08