Lineage for d6j06c1 (6j06 C:298-483)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (63 species)
    not a true protein
  7. 2375328Species Human (Homo sapiens) [TaxId:9606] [187655] (101 PDB entries)
  8. 3067085Domain d6j06c1: 6j06 C:298-483 [367147]
    Other proteins in same PDB: d6j06a2, d6j06b2, d6j06c2
    automated match to d5lyga_
    complexed with 99c, ca, flc, so4

Details for d6j06c1

PDB Entry: 6j06 (more details), 2.65 Å

PDB Description: crystal structure of intracellular b30.2 domain of btn3a1 in complex with hmbpp-08
PDB Compounds: (C:) Butyrophilin subfamily 3 member A1

SCOPe Domain Sequences for d6j06c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j06c1 b.29.1.0 (C:298-483) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aynewkkalfkpadvildpktanpillvsedqrsvqrakepqdlpdnperfnwhycvlgc
esfisgrhywevevgdrkewhigvcsknvqrkgwvkmtpengfwtmgltdgnkyrtltep
rtnlklpkppkkvgvfldyetgdisfynavdgshihtfldvsfsealypvfriltlepta
lticpa

SCOPe Domain Coordinates for d6j06c1:

Click to download the PDB-style file with coordinates for d6j06c1.
(The format of our PDB-style files is described here.)

Timeline for d6j06c1:

  • d6j06c1 is new in SCOPe 2.07-stable