Lineage for d6j0ka1 (6j0k A:298-485)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (63 species)
    not a true protein
  7. 2375328Species Human (Homo sapiens) [TaxId:9606] [187655] (101 PDB entries)
  8. 3067078Domain d6j0ka1: 6j0k A:298-485 [367140]
    Other proteins in same PDB: d6j0ka2, d6j0kb2
    automated match to d5lyga_
    complexed with h6p; mutant

Details for d6j0ka1

PDB Entry: 6j0k (more details), 2 Å

PDB Description: crystal structure of intracellular b30.2 domain of btn3a3 mutant in complex with hmbpp
PDB Compounds: (A:) Butyrophilin subfamily 3 member A3

SCOPe Domain Sequences for d6j0ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j0ka1 b.29.1.0 (A:298-485) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ayhewkmalfkpadvildpdtanaillvsedqrsvqraeeprdlpdnperfewhycvlgc
enftsgrhywevevgdrkewhigvcsknverkkgwvkmtpengywtmgltdgnkyralte
prtnlklpepprkvgifldyetgeisfynatdgshiytfphasfseplypvfriltlept
alticpip

SCOPe Domain Coordinates for d6j0ka1:

Click to download the PDB-style file with coordinates for d6j0ka1.
(The format of our PDB-style files is described here.)

Timeline for d6j0ka1:

  • d6j0ka1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6j0ka2