SCOPe 2.08: Domain d6ived_: 6ive D:

Lineage for d6ived_ (6ive D:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (36 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [367129] (1 PDB entry)

8. Domain d6ived_: 6ive D: [367138]
   Other proteins in same PDB: d6ivea2, d6ivef2
   automated match to d1v3wa_
   complexed with po4, zn

Details for d6ived_

PDB Entry: 6ive, 2.3 Å

PDB Description: molecular structure of a thermostable and a zinc ion binding gamma- class carbonic anhydrase

PDB Compounds: (D:) Ferripyochelin-binding protein

SCOPe Domain Sequences for d6ived_:

Sequence; same for both SEQRES and ATOM records:

>d6ived_ b.81.1.0 (D:) automated matches {Thermus thermophilus [TaxId: 300852]}
msvyrfedktpavhptafiapgayvvgavevgegasiwfgavvrgdlervvvgpgtnvqd
gavlhadpgfpcllgpevtvghravvhgavveegalvgmgavvlngarigknavvgagav
vppgmevpegrlalgvparvvrpidppgnapryralaeryrkalfpv

Timeline for d6ived_:

• d6ived_ first appeared in SCOPe 2.07