Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (92 species) not a true protein |
Species Peucedanum praeruptorum [TaxId:312531] [352603] (2 PDB entries) |
Domain d6iwta1: 6iwt A:17-120 [367135] Other proteins in same PDB: d6iwta2, d6iwtb2 automated match to d1kyze1 complexed with peg |
PDB Entry: 6iwt (more details), 2.53 Å
SCOPe Domain Sequences for d6iwta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6iwta1 a.4.5.0 (A:17-120) automated matches {Peucedanum praeruptorum [TaxId: 312531]} eeeacmfamqlasasvlpmvlksaieldllesiakagpgayvspselaaklpssqpdtpv mldrilrllasysvlkckvqdlpqggverlyalapvckfltkns
Timeline for d6iwta1: