SCOPe 2.08: Domain d6iwtb1: 6iwt B:17-120

Lineage for d6iwtb1 (6iwt B:17-120)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Peucedanum praeruptorum [TaxId:312531] [352603] (2 PDB entries)

8. Domain d6iwtb1: 6iwt B:17-120 [367132]
   Other proteins in same PDB: d6iwta2, d6iwtb2
   automated match to d1kyze1
   complexed with peg

Details for d6iwtb1

PDB Entry: 6iwt, 2.53 Å

PDB Description: crystal structure of methyltransferase comt-s in p. praeruptorum

PDB Compounds: (B:) Pmethyltransferase pCOMT-S

SCOPe Domain Sequences for d6iwtb1:

Sequence; same for both SEQRES and ATOM records:

>d6iwtb1 a.4.5.0 (B:17-120) automated matches {Peucedanum praeruptorum [TaxId: 312531]}
eeeacmfamqlasasvlpmvlksaieldllesiakagpgayvspselaaklpssqpdtpv
mldrilrllasysvlkckvqdlpqggverlyalapvckfltkns

Timeline for d6iwtb1:

• d6iwtb1 first appeared in SCOPe 2.07