Lineage for d6ivec_ (6ive C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403213Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2403214Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2403509Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2403510Protein automated matches [190967] (32 species)
    not a true protein
  7. 3067067Species Thermus thermophilus [TaxId:300852] [367129] (1 PDB entry)
  8. 3067069Domain d6ivec_: 6ive C: [367131]
    Other proteins in same PDB: d6ivea2, d6ivef2
    automated match to d1v3wa_
    complexed with po4, zn

Details for d6ivec_

PDB Entry: 6ive (more details), 2.3 Å

PDB Description: molecular structure of a thermostable and a zinc ion binding gamma- class carbonic anhydrase
PDB Compounds: (C:) Ferripyochelin-binding protein

SCOPe Domain Sequences for d6ivec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ivec_ b.81.1.0 (C:) automated matches {Thermus thermophilus [TaxId: 300852]}
msvyrfedktpavhptafiapgayvvgavevgegasiwfgavvrgdlervvvgpgtnvqd
gavlhadpgfpcllgpevtvghravvhgavveegalvgmgavvlngarigknavvgagav
vppgmevpegrlalgvparvvrpidppgnapryralaeryrkalfpva

SCOPe Domain Coordinates for d6ivec_:

Click to download the PDB-style file with coordinates for d6ivec_.
(The format of our PDB-style files is described here.)

Timeline for d6ivec_:

  • d6ivec_ appears in periodic updates to SCOPe 2.07 starting on 2019-04-04