Lineage for d6hcub2 (6hcu B:229-582)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2532556Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2532557Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2532945Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2532946Protein automated matches [226887] (24 species)
    not a true protein
  7. 2533028Species Plasmodium falciparum [TaxId:36329] [234567] (7 PDB entries)
  8. 3067059Domain d6hcub2: 6hcu B:229-582 [367121]
    Other proteins in same PDB: d6hcua1, d6hcub1
    automated match to d3bjua2
    complexed with fyb, his, lys, peg, trs

Details for d6hcub2

PDB Entry: 6hcu (more details), 1.62 Å

PDB Description: crystal structure of lysyl-trna synthetase from plasmodium falciparum bound to a difluoro cyclohexyl chromone ligand
PDB Compounds: (B:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6hcub2:

Sequence, based on SEQRES records: (download)

>d6hcub2 d.104.1.0 (B:229-582) automated matches {Plasmodium falciparum [TaxId: 36329]}
dteiryrqryldllinessrhtfvtrtkiinflrnflnergffevetpmmnliagganar
pfithhndldldlylriatelplkmlivggidkvyeigkvfrnegidnthnpeftscefy
wayadyndlikwsedffsqlvyhlfgtykisynkdgpenqpieidftppypkvsiveeie
kvtntileqpfdsnetiekminiikehkielpnpptaaklldqlashfienkyndkpffi
vehpqimsplakyhrtkpglterlemficgkevlnaytelndpfkqkecfklqqkdrekg
dteaaqldsafctsleyglpptgglglgidritmfltnknsikdvilfptmrpa

Sequence, based on observed residues (ATOM records): (download)

>d6hcub2 d.104.1.0 (B:229-582) automated matches {Plasmodium falciparum [TaxId: 36329]}
dteiryrqryldllinessrhtfvtrtkiinflrnflnergffevetpmmnliagganar
pfithhndldldlylriatelplkmlivggidkvyeigkvfrnegidnthnpeftscefy
wayadyndlikwsedffsqlvyhlfgtykisynkdgpenqpieidftppypkvsiveeie
kvtntileqpfdsnetiekminiikehkielpnpptaaklldqlashfienkyndkpffi
vehpqimsplakyhrtkpglterlemficgkevlnaytelndpfkqkecfsafctsleyg
lpptgglglgidritmfltnknsikdvilfptmrpa

SCOPe Domain Coordinates for d6hcub2:

Click to download the PDB-style file with coordinates for d6hcub2.
(The format of our PDB-style files is described here.)

Timeline for d6hcub2:

  • d6hcub2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6hcub1