Lineage for d6hcub1 (6hcu B:78-228)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. Protein automated matches [190576] (52 species)
    not a true protein
  7. Species Plasmodium falciparum [TaxId:36329] [234564] (7 PDB entries)
  8. Domain d6hcub1: 6hcu B:78-228 [367120]
    Other proteins in same PDB: d6hcua2, d6hcub2
    automated match to d3bjua1
    complexed with fyb, his, lys, peg, trs

Details for d6hcub1

PDB Entry: 6hcu (more details), 1.62 Å

PDB Description: crystal structure of lysyl-trna synthetase from plasmodium falciparum bound to a difluoro cyclohexyl chromone ligand
PDB Compounds: (B:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6hcub1:

Sequence, based on SEQRES records: (download)

>d6hcub1 b.40.4.0 (B:78-228) automated matches {Plasmodium falciparum [TaxId: 36329]}
vdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitg
rimrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpg
kskkgelsifpketillsaclhmlpmkyglk

Sequence, based on observed residues (ATOM records): (download)

>d6hcub1 b.40.4.0 (B:78-228) automated matches {Plasmodium falciparum [TaxId: 36329]}
vdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitg
rimrvsaqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgks
kkgelsifpketillsaclhmlpmkyglk

SCOPe Domain Coordinates for d6hcub1 are not available.

Timeline for d6hcub1:

Domains from same chain:
(mouse over for more information)
d6hcub2
Domains from other chains:
(mouse over for more information)
d6hcua1, d6hcua2