Lineage for d6hf1e2 (6hf1 E:106-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752642Domain d6hf1e2: 6hf1 E:106-212 [367119]
    Other proteins in same PDB: d6hf1b1, d6hf1c1, d6hf1c2, d6hf1e1, d6hf1f1, d6hf1f2
    automated match to d3cfja2
    mutant

Details for d6hf1e2

PDB Entry: 6hf1 (more details), 1.94 Å

PDB Description: mutant oxidoreductase fragment of mouse qsox1 in complex with an antibody fab
PDB Compounds: (E:) Fab 316 light chain

SCOPe Domain Sequences for d6hf1e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hf1e2 b.1.1.2 (E:106-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d6hf1e2:

Click to download the PDB-style file with coordinates for d6hf1e2.
(The format of our PDB-style files is described here.)

Timeline for d6hf1e2: